Skip to product information
1 of 1

IL-23 Protein, Rat

IL-23 Protein, Rat

Catalog Number: UA040413 Reactivity: Rat Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $356 USD
Regular price Sale price $356 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rat
Synonyms IL-23 p19/IL-12 p40; IL23; IL-23A; Interleukin 23; SGRF
Amino Acid Sequence

IL-23alpha:
VPRSSSPDWAQCQQLSRNLCTLAWSAHTPVGQMDLLREEGEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLLPDSPVDQLHTSLLGLSQLLQPEDHHWETQQMPRLSPSQQWQRSLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
IL-12beta:
MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

Expression System HEK293
Molecular Weight

Approximately 23(IL-23A) & 43-48 kDa((IL-12B))

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH 7.4.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stability & Storage

Stored at -20°C for 2 years from date of receipt. 
After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). 
It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Background

The IL-23 α protein is predicted to exhibit cytokine activity and contribute to interleukin-23 receptor binding. It is also anticipated to be involved in multiple processes, including the positive regulation of cytokine production, lymphocyte activation, and peptidyl-tyrosine phosphorylation. Additionally, it is expected to function upstream of T cell proliferation and in the positive regulation of RNA polymerase II transcription. This protein is localized in the extracellular space and is also predicted to be a component of the interleukin-23 complex. In terms of expression, it shows a bias toward the thymus (RPKM 15.2), spleen (RPKM 11.9), and nine other tissues. It shares orthology with the human *IL23A* gene, which encodes the interleukin-23 subunit alpha.

Components