Skip to product information
1 of 2

Human VEGF 121, His Tag

Human VEGF 121, His Tag

Catalog Number: S0A4007 Brand: Starter
Price:
Regular price $235 USD
Regular price Sale price $235 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Vascular endothelial growth factor A, VEGF-A, VPF
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His)


APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 15.7kDa Actual: 16,20kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Vascular endothelial growth factor (VEGF) is a signal protein produced by many cells that stimulates the formation of blood vessels. To be specific, VEGF is a sub-family of growth factors, the platelet-derived growth factor family of cystine-knot growth factors. They are important signaling proteins involved in both vasculogenesis (the de novo formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature). VEGF121 is the only form that lacks a basic heparinbinding region and is freely diffusible.  It plays an important role in neurogenesis both in vitro and in vivo (Storkebaum et al.). It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. 

Picture

Bioactivity

Immobilized Human VEGF 121, His Tag at 4 μg/mL (50 μL/well) can bind VEGF-R2/KDR Fc Chimera Protein, Human (Cat. No. UA010144) with EC50 of 17-22 ng/mL.

SDS-PAGE

2μg (R: reducing conditions)