Skip to product information
1 of 1

Human Cathepsin D Protein, His tag

Human Cathepsin D Protein, His tag

Catalog Number: S0A0162 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $645 USD
Regular price Sale price $645 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cathepsin D, CTSD, CPSD
Accession P07339
Amino Acid Sequence

Protein sequence (P07339, Leu21-Leu412, with C-His tag) LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Expression System HEK293
Molecular Weight Predicted MW: 44.3 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Citrate Buffer, 150mM NaCl, pH6.0.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cathepsin D is a protein that in humans is encoded by the CTSD gene. This gene encodes a lysosomal aspartyl protease composed of a protein dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes. The main function of cathepsin D is to degrade proteins and activate precursors of bioactive proteins in pre-lysosomal compartments. This proteinase, which is a member of the peptidase A1 family, has a specificity similar to but narrower than that of pepsin A. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease.

Picture

SDS-PAGE

2μg(R: reducing conditions)

Presepsin (sCD14-ST) was prepared by cleavage of the Human CD14, hFc tag (Cat. No. S0A1048) by Human Cathepsin D Protein, His tag. Human CD14, hFc tag (100 μg) was reconstituted using a digestion buffer [0.1 M glycine–HCl (pH 3.5), 0.1% Tween-20, and 0.15 M NaCl] to obtain 1 μg/μL solution. The pH was adjusted to 3.5 using 1 M HCl. Then, 3.33 μg of Human Cathepsin D Protein, His tag was added and incubated for 1 h at 37 °C. The reaction solution was analyzed using SDS-PAGE.