Skip to product information
1 of 1

Mouse Soluble IL2R alpha/CD25 Protein, His Tag

Mouse Soluble IL2R alpha/CD25 Protein, His Tag

Catalog Number: S0A1142 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $235 USD
Regular price Sale price $235 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Interleukin-2 receptor subunit alpha, IL-2 receptor subunit alpha, IL-2-RA, IL-2R subunit alpha, IL2-RA, p55, CD25, Il2ra, Il2r
Accession P01590
Amino Acid Sequence

Protein sequence (P01590, Glu22-Lys236, with C-His Tag) ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Expression System HEK293
Molecular Weight Predicted MW: 26.4 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The interleukin-2 receptor alpha chain (also called Tac antigen, P55, and mainly CD25) is a protein involved in the assembly of the high-affinity interleukin-2 receptor, consisting of alpha (IL2RA), beta (IL2RB) and the common gamma chain (IL2RG). This receptor interacts with interleukin-2, a pleiotropic cytokine which plays an important role in immune homeostasis. Quantification of soluble IL2RA is a useful and simple tool for clinicians to assess immune function in vivo as part of the investigation, management, and prognosis of a broad spectrum of diseases, such as sarcoidosis, Multiple Sclerosis, primary biliary cirrhosis, Chronic immune activation in common variable immunodeficiency (CVID), chronic liver diseases and many more.

Picture

Bioactivity

Immobilized IL-2 Protein, Mouse (Cat. No. UA040171) at 2 μg/mL (100 μL/well) can bind Mouse IL-2R alpha/CD25 Protein, His tag with EC50 of 10.5-15.3 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)