IL-12 R beta 1 His Tag Protein, Human
IL-12 R beta 1 His Tag Protein, Human
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | IL-12 R beta 1, CD212, IMD30, IL12RB |
| Accession | P42701 |
| Amino Acid Sequence | Cys24-Glu540, with C-terminal 8* His CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 74-84kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Oppmann B. et al. (2000) Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12. Immunity. 13(5): 715-725. 2、Robinson R T. IL12Rbeta1: the cytokine receptor that we used to know. Cytokine. 2015;71(2): 348-359. |
Background
The human IL-12 R subunit is a member of the cytokine receptor superfamily. The IL-12 R beta (IL-12Rβ) gene is located on chromosome 19p13 and has 17 exons. The receptor is composed of two subunits—IL-12Rβ1 and IL-12Rβ2—and is a member of the gp130 cytokine receptor superfamily. IL-12R are located mainly on T cells and NK cells, and stimulate TH1 and NK cell growth, while inhibiting TH2 cell responses. IL-12Rβ1 encodes the β1 chain common to the receptors for IL-12 and IL-23. Human IL-12Rβ1 is an autosomal gene that is essential for mycobacterial disease resistance and T cell differentiation. Mutations in the IL-12Rβ1 gene accounts for 38% of cases of MSMD. IL12Rβ1 is a cell surface receptor that binds the IL12p40 domain of IL12/IL23, and cooperates with co-receptors IL12Rβ2 or IL23R to initiate intracellular STAT signaling.
Picture
Picture
SDS-PAGE
