Skip to product information
1 of 2

Human RBP4 , His tag

Human RBP4 , His tag

Catalog Number: S0A9007 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Plasma retinol-binding protein (PRBP; RBP)
Accession P02753
Amino Acid Sequence

Protein sequence(P02753, Glu19-Leu201, with C-10*His) ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:22.7kDa Actual:24kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Retinol binding protein 4, also known as RBP4, is a transporter protein[5] for retinol (vitamin A alcohol). It is mainly, though not exclusively, synthesized in the liver and circulates in the bloodstream as a hepatokine bound to retinol in a complex with transthyretin. RBP4 has been a drug target for ophthalmology research due to its role in vision. RBP4 may also be involved in metabolic diseases as suggested by recent studies. Retinol-binding protein 4 in urine (uRBP4) is a functional biomarker of disease of the proximal renal tubule1. When proximal tubular dysfunction interferes with reabsorption of proteins filtered by the renal glomerulus, striking increases of uRBP4 are found.

Picture

Bioactivity

Immobilized Human RBP4, His tag at 1 μg/mL (50 μL/well) can bind RBP4 Recombinant Rabbit mAb (S-693-111) (Cat. No. S0B0605) with EC50 of 3.388-3.785 ng/ ml.

SDS-PAGE

2μg(R: reducing conditions)