Skip to product information
1 of 1

Human Myoglobin, His Tag

Human Myoglobin, His Tag

Catalog Number: S0A0004 Brand: Starter
Price:
Regular price $170 USD
Regular price Sale price $170 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms symbol Mb, MB
Accession P02144
Amino Acid Sequence

Protein sequence (P02144, Met1-Gly154 with C-10*His)


MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 18.8kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

Myoglobin (symbol Mb or MB) is an iron- and oxygen-binding protein found in the cardiac and skeletal muscle tissue of vertebrates in general and in almost all mammals. Myoglobin is distantly related to hemoglobin. Compared to hemoglobin, myoglobin has a higher affinity for oxygen and does not have cooperative binding with oxygen like hemoglobin does. In humans, myoglobin is only found in the bloodstream after muscle injury. Myoglobin is a sensitive marker for muscle injury, making it a potential marker for heart attack in patients with chest pain. However, elevated myoglobin has low specificity for acute myocardial infarction (AMI) and thus CK-MB, cardiac troponin, ECG, and clinical signs should be taken into account to make the diagnosis.

Picture

SDS-PAGE

2μg (R: reducing conditions)