Skip to product information
1 of 1

Human IGF-2 Protein, hFc tag

Human IGF-2 Protein, hFc tag

Catalog Number: S0A4045 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $144.00 SGD
Regular price Sale price $144.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Insulin-like growth factor II, IGF-II, Somatomedin-A, T3M-11-derived growth factor, IGF2
Accession P01344
Amino Acid Sequence

Protein sequence (P01344, Ala25-Glu91, with N-hFc tag) AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Expression System HEK293
Molecular Weight

Predicted MW: 34.6 kDa Observed MW: 40 kDa

Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. It has growth-regulating, insulin-like and mitogenic activities. It is believed to be a major fetal growth factor. The major role of IGF-2 is as a growth promoting hormone during gestation. IGF-2 exerts its effects by binding to the IGF-1 receptor and to the short isoform of the insulin receptor (IR-A or exon 11-). IGF-2 may also bind to the IGF-2 receptor (also called the cation-independent mannose 6-phosphate receptor), which acts as a signalling antagonist. IGF-2 acts as a co-hormone together with both FSH and LH. IGF-2 is sometimes produced in excess in islet cell tumors and non-islet hypoglycemic cell tumors, causing hypoglycemia. Loss of imprinting of IGF-2 is a common feature in tumors seen in Beckwith-Wiedemann syndrome. As IGF-2 promotes development of fetal pancreatic beta cells, it is believed to be related to some forms of diabetes mellitus.

Picture

Bioactivity

Immobilized Human IGFBP-4, His tag (Cat. No. S0A6002) at 2 μg/mL (50 μL/well) can bind Human IGF-2 Protein, hFc Tag with EC50 of 39.02-43.08 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)