Skip to product information
1 of 1

Human FGF19 Protein, His tag

Human FGF19 Protein, His tag

Catalog Number: S0A4050 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $306.00 SGD
Regular price Sale price $306.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Fibroblast growth factor 19, FGF-19
Accession O95750
Amino Acid Sequence

Protein sequence (O95750, Met1-Lys216, with C-His tag) MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Expression System HEK293
Molecular Weight Predicted MW: 25.7 kDa Observed MW: 24 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.02M Citrate Buffer, pH6.0.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Fibroblast growth factor 19 is a protein that in humans is encoded by the FGF19 gene. The protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. It functions as a hormone, regulating bile acid synthesis, with effects on glucose and lipid metabolism. Reduced synthesis, and blood levels, may be a factor in chronic bile acid diarrhea and in certain metabolic disorders. FGF19 is frequently amplified in human cancers. Amplification of the FGF19 genomic locus was found in liver cancer, breast cancer, lung cancer, prostate cancer, bladder cancer, and esophageal cancer, among others. Targeting FGF19 inhibits tumor growth in colon cancer cells and hepatocellar carcinoma.

Picture

Bioactivity

Immobilized Human FGF19 Protein, His tag at 2 μg/mL (100 μL/well) can bind Recombinant Human FGFR-4/CD334 Protein with EC50 of 0.24-0.52 μg/ml.

SDS-PAGE

2 μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)