Skip to product information
1 of 1

Human CD63, His tag

Human CD63, His tag

Catalog Number: S0A1008 Brand: Starter
Price:
Regular price $385 USD
Regular price Sale price $385 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Lysosome integral membrane protein 1 (Limp1), Melanoma-associated antigen ME491, OMA81H
Accession P08962
Amino Acid Sequence

Protein sequence(P08962, Ala103-Val203, with C-10*His)
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13.2kDa Actual:17-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

CD63 is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak Syndrome. Also this protein has been associated with tumor progression. CD63 is a good marker for flow cytometric quantification of in vitro activated basophils for diagnosis of IgE-mediated allergy.

Picture

SDS-PAGE

2μg (R: reducing conditions)