Skip to product information
1 of 1

CLEC3B His Tag Protein, Human

CLEC3B His Tag Protein, Human

Catalog Number: UA010128 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $778.00 SGD
Regular price Sale price $778.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P05452
Amino Acid Sequence

Glu22-Val202, with C-terminal 6*His

EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIVGGGSHHHHHH

Expression System HEK293
Molecular Weight 24-30kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

C-type lectin domain family 3 member B (CLEC3B) is a hexameric, multimodular extracellular matrix protein with several molecular forms that are created through alternative splicing and protein modifications. It is highly conserved amongst vertebrates, and molecular phylogeny indicating that it evolved before fibronectin. CLEC3B has many extracellular binding partners, including matrix components, soluble factors and pathogens; it also influences cell phenotype directly through interactions with cell surface receptors. The synthesis of CLEC3B is strictly regulated, and it is widely distributed in embryonic tissues while restricted in adult tissues. CLEC3B is also de novo expressed in wound healing or pathological state, including chronic inflammation and cancer. First described as a modulator of cell adhesion, CLEC3B also directs a plethora of cell signaling and gene expression programs by shaping mechanical and biochemical cues in the cellular microenvironment. Exploitation of the pathological expression and function of CLEC3B is emerging as a promising strategy to develop new diagnostic, therapeutic and bioengineering tools.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

RP-HPLC

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)