Skip to product information
1 of 1

Sortase A

Sortase A

Catalog Number: UA070086 Reactivity: Other Conjugation: Brand: UA BIOSCIENCE
Price:
Regular price $444.00 SGD
Regular price Sale price $444.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Staphylococcus aureus
Synonyms LPXTG specific sortase A, sortase, Srt A
Expression System E.coli
Molecular Weight

25 kDa (Reducing)

Purity >98% by SDS-PAGE
Tag No Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris-HCl, 100mM NaCl, 2.5mM KCl, pH 8.0, 0.04% Tween 20, 20%甘油
Stability & Storage

Store at -25 ~ -15℃ for 1 years,Avoid freeze / thaw cycle

Reference

1. Frankel B A, Kruger R G , Robinson D E ,et al. Staphylococcus aureus sortase transpeptidase SrtA: insight into the kinetic mechanism and evidence fora reverse protonation catalytic mechanism.[J].Biochemistry, 2005, 44(33):11188-11200.
2. Parthasarathy R, Subramanian S, Boder E T. Sortase A as a Novel Molecular "Stapler" for Sequence-Specific Protein Conjugation[J]. Bioconjugate Chemistry, 2007, 18(2):469-476.

Background

Sortase is a family of transpeptidases found in Gram-positive bacteria, which is divided into two subfamilies: Sortase A and Sortase B. Its main function is to catalyze the covalent attachment of cell surface proteins to the cell wall. Among them, Sortase A (SrtA) has been studied more extensively. Sortase A (SrtA) can specifically recognize proteins with a C-terminal conserved amino acid sequence LPXTG and an N-terminal polyglutamine (X is any amino acid except cysteine and tryptophan).

Components

0.5 ug/ul Sortase A in 50mM Tris-HCl, 100mM NaCl, 2.5mM KCl, 0.04% Tween 20,20%甘油, pH 8.0 @ 25°C
3×Reaction Buffer:100mM Tris-HCl、50mM CaCl2、20mM DTT, pH 7.5 @ 25°C

Protocol

1. Typical polypeptide reaction conditions are as follows:

Components

Volume

Final Concentration

Polypeptide 1 (1 mM)

5 µl

166 uM

Polypeptide 2 (1 mM)

5 µl

166 uM

Sortase A (0.5 ug/ul)

5 µl

-

3X Reaction Buffer

10 µl

1X

ddH2O

Up to 30µl

-

2. After preparation according to the above table, mixed centrifugation, reaction at 30℃ for 1-3h, and SDS-PAGE electrophoresis was performed after reaction.

Guidelines

Avoid freeze / thaw cycle

This product is for research use only.

Picture

Bioactivity

Sortase A can specifically identify the peptide sequence LPXTG. Synthetic peptide 1 (YGVRLCGREFIRAVIF-TCGGSRWRRKGGLPRTGG) and peptide 2 (GGGGSGGRRSRRSRQDLQTLCCTDGCSMTDLSALC) to connect, conduct experiments and tests.
Lane 1 Polypeptide 1;
Lane 2 Polypeptide 2;
Lane 3 Negative Control (negative control with no added enzyme only);
Lane 4 UA-Sortase A: 1 ug;
Lane 5 UA-Sortase A: 2.5 ug;
Lane 6 UA-Sortase A: 4 ug;
Lane 7 UA-Sortase A: 5 ug;

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).

SEC-HPLC

98.4%

RP-HPLC

99.6%