2μg (R: reducing conditions, N: non-reducing conditions).
EphA6 His Tag Protein, Human
EphA6 His Tag Protein, Human
Price:
Regular price
$726.00 SGD
Regular price
Sale price
$726.00 SGD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Antigen | EphA6 |
| Synonyms | Ehk2 Protein, Hek12 Protein, m-ehk2 Protein |
| Accession | Q9UF33 |
| Amino Acid Sequence | Typ23-Val550, with C-terminal 10*His WPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 65-73kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1． Gitanjali Das, Qili Yu, Ryan Hui, Kenneth Reuhl, Nicholas W. Gale & Renping Zhou Cell & Bioscience volume 6, Article number: 48 (2016). |
Background
Ephrin-a receptor 6, also known as EphA6 or EHK2, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. Eph receptor and its ligand ephrin play an important role in neuronal migration, axon binding and specific target guidance, dendritic spine formation and neuroplasticity. Studies have shown that EphA5 and EphA6 are significantly expressed in perinatal development and in the cerebral cortex of adult mice, so EphA5 and EphA6 play an important role in regulating the cellular structure of cortical neurons.
Picture
Picture
SDS-PAGE
ELISA
Immobilized EphA6 His Tag, Human (Cat. No. UA010591) at 1.0μg/mL (100μL/well) can bind Ephrin-A3 Fc Chimera, Human (Cat. No. UA010141) with EC50 of 0.71-1.11μg/ml.
SPR
Protein A Chip captured Ephrin-A3 Fc Chimera, Human (Cat. No. UA010141), can bind EphA6 His Tag, Human (Cat. No. UA010591) with an affinity constant of 0.35μM as determined in SPR assay.
