Skip to product information
1 of 5

ACVR2B Fc Chimera Protein, Human

ACVR2B Fc Chimera Protein, Human

Catalog Number: UA010213 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $622.00 SGD
Regular price Sale price $622.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms ACVR2B, Activin Receptor Type-2B, ACTRIIB, MGC116908
Accession Q13705
Amino Acid Sequence

Ser19-Thr134, with C-terminal Human IgG Fc

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

56-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Attisano L. et al. (1996) Activation of signalling by the activin receptor complex. Mol Cell Biol. 16(3): 1066-1073.

2、Woodruff T K. et al. (1998) Regulation of cellular and system function by activin. Biochem Pharmacol. 55(7): 953-963.

Background

Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Activin A Protein, Human (Cat. No. UA040343) at 1.0μg/mL (100μL/well) can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213)  with EC50 of 9.27-13.85ng/mL.

Immobilized Activin A Protein, Human (Cat. No. UA040178) at 1.0μg/mL (100μL/well) can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213)  with EC50 of 6.69-11.23ng/mL.

SPR

CM5 Chip captured Activin A Protein, Human/Mouse/Rat (Cat. No. UA040343), can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213) with an affinity constant of 18.28nM as determined in SPR assay.

CM5 Chip captured Activin A Protein, Human (Cat. No. UA040178), can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213) with an affinity constant of 12.40nM as determined in SPR assay.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)