Skip to product information
1 of 1

ST6/CD82 His Tag Protein, Human

ST6/CD82 His Tag Protein, Human

Catalog Number: UA010579 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $792 USD
Regular price Sale price $792 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen ST6/CD82
Synonyms KAI1, SAR2, TSPAN27
Accession P27701-1
Amino Acid Sequence

Gly111-Leu228, with C-terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Jin?Woo Lee,Yoo?Wook Kwon, Cheong?Whan Chae, Jae?Il Choi, Injoo Hwang,Ji?Yeon Yun, Jin?A Kang, Young?Eun Choi, Young Hyun Kim, Sang Eun Lee. KAI1(CD82) is a key molecule to control angiogenesis and switch angiogenic milieu to quiescent state. Lee et al. J Hematol Oncol (2021) 14:148 https://doi.org/10.1186/s13045-021-01147-6.

Background

KAI1/CD82, a transmembrane protein and a member of the tetraspanin superfamily, is an evolutionally conserved molecule expressed in various tissue types. First identified to be involved in the T cell activation process, KAI1 is typically considered as a suppressor of metastasis. Most studies of KAI1 examined its function in suppressing metastasis and angiogenesis mainly in cancer cells and endothelial cells. Recently, we and others have reported that KAI1 regulates the cell cycle progression of the long-term repopulating hematopoietic stem cells (LT-HSCs) and muscle stem-progenitor cells. Thus, KAI1 has different roles in each cell and organ type.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).