Skip to product information
1 of 2

Spike RBD His Tag, SARS-CoV-2 (BA.4 /Omicron)

Spike RBD His Tag, SARS-CoV-2 (BA.4 /Omicron)

Catalog Number: S0A2042 Brand: Starter
Price:
Regular price $500 USD
Regular price Sale price $500 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 35-40 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Coronaviruses (CoVs) are enveloped viruses with a positive sense RNA genome, that belong to the subfamily Coronavirinae within the family Coronaviridae, which is part of the Nidovirales order. The CoV virion contains at least four structural proteins: spike (S), envelope (E), membrane (M) and nucleocapsid (N). Among them, the S protein plays an essential role in viral attachment, fusion, entry, and transmission. It comprises an N-terminal S1 subunit responsible for virus–receptor binding and a C-terminal S2 subunit responsible for virus–cell membrane fusion. S1 is further divided into an N-terminal domain (NTD) and a receptor-binding domain (RBD). During infection, CoV first binds the host cell through interaction between its S1-RBD and the cell membrane receptor, triggering conformational changes in the S2 subunit that result in virus fusion and entry into the target cell.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured Spike RBD His Tag, SARS-CoV-2 (BA.4/Omicron) (Cat. No. UA030024), can bind ACE2 Fc Chimera, Human (Cat. No. UA020026) with an affinity constant of 0.162 μM as determined in SPR assay (Biacore T200).

SDS-PAGE

Spike RBD His Tag, SARS-CoV-2 (BA.4/Omicron),2μg(R: reducing conditions, N: non-reducing conditions).

RP-HPLC