Protein
A Chip captured IL-6R alpha/CD126 Fc Chimera, Human (Cat. No. UA010448), can
bind IL-6, Human (Cat. No. UA040052) with an affinity constant of 8.51 nM as determined in SPR assay.
IL-6R alpha/CD126 Fc Chimera Protein, Human
IL-6R alpha/CD126 Fc Chimera Protein, Human
Price:
Regular price
$594.00 USD
Regular price
Sale price
$594.00 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Antigen | IL-6R alpha/CD126 |
| Synonyms | IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA |
| Accession | P08887 |
| Amino Acid Sequence |
Leu20 - Pro365, with C-terminal Human IgG1 Fc LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 76-93 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1.M Hibi, M Murakami, M Saito, T Hirano, T Taga, TKishimoto. Molecular cloning and expression of an IL-6 signal transducer,gp130.Cell. 1990 Dec 21;63(6):1149-57. |
Background
The Interleukin-6 receptor (IL-6R) consists of an 80-kDa IL-6 binding protein (α chain) (CD126) and gp130. The alpha-chain CD126 is a glycoprotein that contains the ligand-binding site. The human IL-6R protein contains 468 amino acids, which includes a signal peptide, an extracellular region, a transmembrane domain, and a short cytoplasmic domain of 19, 339, 28, and 82 amino acids, respectively. IL-6R are present on several types of tumor cells, including multiple myeloma, hepatocellular carcinoma, prostate carcinoma , and epidermoid carcinoma. The IL-6/IL-6R signal pathway promotes the tumor growth in various cancers, especially for glioma. Hence, IL-6R not only can be used as a target site for transporting drugs, but also as a therapeutic site. Primary human cartilage cells express IL-6R, which is further induced in the presence of IL-6. This makes cartilage cells direct targets or effectors of IL-6.
Picture
Picture
Bioactivity
SDS-PAGE
2μg (R: reducing conditions, N: non-reducing conditions).
ELISA
Immobilized IL-6, Human (Cat. No. UA040052) at 5.0μg/mL (100μL/well) can bind IL-6R alpha/CD126 Fc Chimera, Human (Cat. No. UA010448) with EC50 of 3.04-3.92ng/ml.
