Dose-dependent changes in STAT3 phosphorylation by DH-82 cells in response to Recombinant Canine IL-31 His,The EC50 for this effect is 80- 200ng/mL in the presence of 20ng/mL Recombinant Canine IFN-γ.
IL-31 Protein, Canine
IL-31 Protein, Canine
Price:
Regular price
$338.00 USD
Regular price
Sale price
$338.00 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Canine |
| Synonyms | IL-31,IL31,Interleukin-31 |
| Accession | C7G0W1 |
| Amino Acid Sequence |
Ser24-Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 17kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4, 5% Trehalose. |
| Reconstitution | econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print. |
Background
IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.
Picture
Picture
Bioactivity
SDS-PAGE
1μg ( R: reducing condition, N: non-reducing condition).
ELISA
Measured by its binding ability in a functional ELISA. When Recombinant Canine IL-31 His Tag is immobilized 2.5µg/mL (100µL/well), Recombinant Canine OSMR Fc Chimera binds with an EC50 of 0.02-0.04μg/ml.
Measured by its binding ability in a functional ELISA. When Recombinant Canine OSMR Fc Chimera is immobilized 2.5µg/mL (100µL/well), Recombinant Canine IL-31 His tag binds with an EC50 of 1.2-1.4μg/ml.
