Skip to product information
1 of 2

CD7 Ligand/SECTM1 His Tag Protein, Human

CD7 Ligand/SECTM1 His Tag Protein, Human

Catalog Number: UA010298 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $504 USD
Regular price Sale price $504 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal 8*His QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 17-22kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured CD7 Ligand/SECTM1 His Tag, Human(Cat. No. UA010298), can bind CD7 Fc Chimera, Human(Cat. No. UA010411) with an affinity constant of 0.38nM as determined in SPR assay.

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).