Skip to product information
1 of 2

CD52 Fc Chimera Protein, Human

CD52 Fc Chimera Protein, Human

Catalog Number: UA010305 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $540 USD
Regular price Sale price $540 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Epididymis Secretory Sperm Binding Protein Li 171mP, CD52 Antigen (CAMPATH-1 Antigen), Epididymal Secretory Protein E5, He5, CDW52 Antigen, HEL-S-171mP, EDDM5, CDw52, Cambridge pathology 1 antigen, Human epididymis-specific protein 5, CD52
Accession P31358
Amino Acid Sequence

Gly25-Ser36, with C-terminal Human IgG1 Fc GQNDTSQTSSPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

35-40kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Koyama K. et al. (2009) Functional aspects of CD52 in reproduction. J Reprod Immunol. 83(1-2): 56-59.

Background

CD52, also known as CAMPATH-1 antigen, HE5, and gp20, is a cell surface glycoprotein that can be targeted to induce immune suppression by complement-mediated cell lysis. CD52 is a GPI-anchored protein present in lymphocytes and male reproductive tissues (mrt) including mature sperm and seminal plasma. It has been shown that mrt-CD52 is synthesized in epithelial cells of the epididymis and vas deferens, but not in the testis. The mrt-CD52 is transported to mature sperm during sperm transition in the male reproductive tract. Lymphocyte CD52 functions to stimulate suppressor T cell induction, while mrt-CD52 is associated with seminogelin and involved in clot formation and liquefaction of semen. It protects sperm against anti-sperm antibodies by binding to C1q and inhibiting complement activation.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CD52 Fc Chimera Protein, Human (Cat. No. UA010305) at 2μg/mL (100μL/well) can bind CD52 Recombinant Mouse mAb (S-R431) (Cat. No. S0B0685) with EC50 of 19.86-24.09ng/ml.