Skip to product information
1 of 2

CD5 His Tag Protein, Human

CD5 His Tag Protein, Human

Catalog Number: UA010390 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $618 USD
Regular price Sale price $618 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD5, LEU1
Accession P06127
Amino Acid Sequence

Arg25-Asn371, with C-terminal 10*His RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

50-55kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Zola H. et al. (2007) CD molecules 2006-human cell differentiation molecules. J Immunol Methods. 318(1-2): 1-5.

2、Ho I C. et al. (2009) GATA3 and the T-cell lineage: essential functions before and after T-helper-2-cell differentiation. Nat Rev Immunol. 9(2): 125-135.

3、Matesanz-Isabel J. et al. (2011) New B-cell CD molecules. Immunology Letters. 134(2): 104-112.

Background

CD5, one of the earliest markers used to identify T cells, is a 67 kD transmembrane molecule that is constitutively expressed on all T cells and is a negative regulator of lymphocyte function. T-cell surface glycoprotein CD5 is also known as Lymphocyte antigen T1/Leu-1 and LEU1. CD5 is also a negative regulator of thymus cell stimulation. Lack of CD5 promotes positive selection of poorly selected thymocytes and increases negative selection of high-affinity clones. Along with its negative effect on T cell stimulation, CD5 was shown to diminish activation-induced cell death (AICD) through its interaction with casein kinase 2 (CK2).

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized CD5 His Tag Protein, Human (Cat. No. UA010390) at 2.0μg/mL (100μL/well) can bind CD5 Mouse mAb (S-576-35)  with EC50 of 3.75-7.94 ng/mL.