Skip to product information
1 of 2

Biotinylated Nectin-2/CD112 His&Avi Tag Protein, Human

Biotinylated Nectin-2/CD112 His&Avi Tag Protein, Human

Catalog Number: UA010352 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $560 USD
Regular price Sale price $560 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD112, Nectin-2, PVRL2
Accession Q92692-2
Amino Acid Sequence

Gln32-Leu360, with C-terminal 8*His&Avi tag QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

45-54kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Minai-Fleminger Y. et al. (2009) Mast cells and eosinophils: the two key effector cells in allergic inflammation. Inflammation Research. 58(10): 631-638.

Background

Nectin-2, also known as CD112, is a cell adhesion molecule that belongs to the Nectin family. Nectin is highly homologous to human poliovirus receptors and also known as a poliovirus receptor-associated protein. The Nectin family consists of four members: Nectin-1, Nectin-2, Nectin-3, and Nectin-4. Nectin protein had three consecutive immunoglobulin-like domains outside the cell, namely, the Ig-V domain at the N terminal and two Ig-C2 domains at the C terminal. Nectin-2 is found in neurons, endothelial cells, epithelial cells, and fibroblasts. Nectin-2 can bind pseudorabies virus and herpes simplex virus-2 (HSV-2) and participate in the intercellular transmission of these viruses, but cannot bind HSV-1 and has a low binding affinity with TIGIT. Nectin-2 was identified as a ligand for DNAM-1 (CD226), whose CD226/CD112 interaction mediates cytotoxicity and cytokine secretion in T and NK cells.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Biotinylated Nectin-2/CD112 His&Avi Tag, Human (Cat. No. UA010352)at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind DNAM-1/CD226 Fc Chimera Protein, Human (Cat. No. UA010560) with EC50 of 65.11-82.64ng/ml.