Skip to product information
1 of 1

Biotinylated CD47 His&Avi Tag Protein, Mouse

Biotinylated CD47 His&Avi Tag Protein, Mouse

Catalog Number: UA010624 Reactivity: Mouse Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $1,168 USD
Regular price Sale price $1,168 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms MER6, IAP, OA3
Accession Q61735-1
Amino Acid Sequence

Gln19-Lys140, with C-terminal 8*His&Avi tag QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight 33-43kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135. 2. Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-1327. 3. Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).