Skip to product information
1 of 2

B7-H6/NCR3LG1 His Tag Protein, Human

B7-H6/NCR3LG1 His Tag Protein, Human

Catalog Number: UA010054 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $540 USD
Regular price Sale price $540 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession Q68D85
Amino Acid Sequence Asp25-Ser262, with C-terminal 8*His DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 45-60 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

B7-H6 (encoded by gene NCR3LG1) is a type I transmembrane protein of B7 family. It consists of two extracellular Ig-like domains (IgV and IgC), an α-helical transmembrane domain, and a C-terminal sequence homologous to group-specific antigen (GAG) proteins. This C-terminal sequence has various signaling motifs, including ITIM-, SH-2-, and SH-3-binding motifs. B7-H6 can bind its receptor NKp30 to exert anti-tumor effects by helping NK cells to recognize abnormal cells. B7-H6 is expressed in several tumor cell lines, both in vitro and in vivo, including esophageal squamous cell carcinoma, oral squamous cell carcinoma and breast cancer. but remains undetected in healthy cells thus far, and is therefore an excellent tumor marker. In recent years, B7-H6 expression has been reported to be upregulated in certain cancers and to be associated with tumor differentiation, stage and progression.

Picture

Bioactivity

Immobilized NKp30/CD337 Fc Chimera, Human (Cat. No. UA010046) at 10μg/mL (100μL/well) can bind B7-H6/NCR3LG1 His Tag, Human (Cat. No. UA010054) with EC50 of 0.57μg/mL.

SDS-PAGE

1 μg(R: reducing conditions, N: non-reducing conditions).