Skip to product information
1 of 1

Monkeypox virus L1R, His Tag

Monkeypox virus L1R, His Tag

Catalog Number: S0A2002 Brand: Starter
Price:
Regular price $300 USD
Regular price Sale price $300 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species MPXV
Synonyms Monkeypox,Mpox
Accession Q8V4Z7
Amino Acid Sequence

MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight 19.4 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.

·1 month, 2 to 8 °C under sterile conditions after reconstitution.

·Please avoid repeated freeze-thaw cycles.

Background

L1R is highly homologous to vaccinia virus protein J1R. Vaccinia virus contains a conserved J1R open reading frame that encodes a late protein of 17.8 kDa. The 18-kDa J1R protein is associated mainly with the membrane fraction of intracellular mature virus particles.

Picture

SDS-PAGE

3μg (R: reducing conditions)