Skip to product information
1 of 1

Parvalbumin His Tag Protein, Human

Parvalbumin His Tag Protein, Human

Catalog Number: UA010608 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $560 USD
Regular price Sale price $560 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen Parvalbumin
Synonyms PVALB, D22S749
Accession P20472
Amino Acid Sequence

Met1-Ser110, with N-terminal 8*His HHHHHHHHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Expression System E.coli
Molecular Weight 16kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Virchows Arch. 2021 Apr;478(4):785-791. Epub 2020 Jun 10.

Background

Parvalbumin is a cytosolic calcium-binding protein expressed in the distal convoluted tubule of the renal nephron that is structurally and functionally similar to calmodulin and troponin C. Among epithelial renal tumors, the reactivity for parvalbumin is observed in chromophobe renal cell carcinomas and frequently in oncocytomas. This protein is thought to be involved in muscle relaxation.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).