Skip to product information
1 of 1

MSLN/Mesothelin (37-286) His Tag Protein, Human

MSLN/Mesothelin (37-286) His Tag Protein, Human

Catalog Number: UA010155 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $600 USD
Regular price Sale price $600 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession Q13421-1
Amino Acid Sequence

Leu37-Arg286, with C-terminal 8*His

LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERHHHHHHHH

Expression System HEK293
Molecular Weight 30-33kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Mesothelin (MSLN) is also known as CAK1 antigen, Pre-pro-megakaryocyte potentiating factor, which belongs to the mesothelin family. Mesothelin/MSLN can be proteolytically cleaved into the following two chains by a furin-like convertase: Megakaryocyte-potentiating factor (MPF) and the cleaved form of mesothelin. Both MPF and the cleaved form of mesothelin are N-glycosylated. Mesothelin/MSLN can interacts with MUC16. The membrane-anchored form of MSLN may play a role in cellular adhesion. MPF potentiates megakaryocyte colony formation in vitro.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

RP-HPLC