Skip to product information
1 of 1

Mouse CD137, His tag

Mouse CD137, His tag

Catalog Number: S0A1024 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, Tnfrsf9, Ila, Ly63
Accession P20334
Amino Acid Sequence

Protein sequence (P20334, Val24-Leu187, with C-10*His) VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.2 kDa Observed MW: 28, 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD137, a member of the tumor necrosis factor (TNF) receptor family, is a type 1 transmembrane protein, expressed on surfaces of leukocytes and non-immune cells.[1] Its alternative names are tumor necrosis factor receptor superfamily member 9 (TNFRSF9), 4-1BB, and induced by lymphocyte activation (ILA). It is of interest to immunologists as a co-stimulatory immune checkpoint molecule, and as a potential target in cancer immunotherapy.

Picture

Bioactivity

Immobilized Mouse CD137, His tag at 2 μg/mL (100 μL/well) can bind 4-1BB ligand/TNFSF9 Fc Chimera Protein, Mouse with EC50 of 0.8-1.0 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)