Skip to product information
1 of 2

KIF7 Protein

KIF7 Protein

Catalog Number: UA080144 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $536 USD
Regular price Sale price $536 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Kinesin-like protein KIF7,KIF7
Accession Q2M1P5
Amino Acid Sequence

L8-V355

LPGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVVLAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIVPRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCGVKEVDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRGRAPSRLPRPAPGQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIPYRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATV


Expression System E.coli
Molecular Weight 40.2 kDa
Purity >90% by SDS-PAGE
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Picture

Bioactivity

The KIF7 activity was detected using Ultra Luminescence technology. The reaction was performed by incubating the KIF7 protein, ATP and substrate at 25℃ for 60 min, then adding ADP-Glo reagent at 25℃ for 40 min and reading RLU signal with BMG.

SDS-PAGE