Skip to product information
1 of 2

IGFBP-7 His Tag Protein, Human

IGFBP-7 His Tag Protein, Human

Catalog Number: UA010394 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $700 USD
Regular price Sale price $700 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IGFBP-7, IBP7, MAC25, PSF
Accession Q16270
Amino Acid Sequence

Asp30-Leu282, with N-terminal 10*His HHHHHHHHHHGGGSGGGSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Expression System HEK293
Molecular Weight

33-36kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lin J. et al. (2007) Methylation patterns of IGFBP7 in colon cancer cell lines are associated with levels of gene expression. J Pathol. 212(1): 83-90.

Background

Insulin-like growth factor binding protein-7 (IGFBP7) is a member of the IGFBP family, which binds insulin with high affinity and IGF with low affinity. IGFBP7 was originally identified in normal mammary epithelial cells and meningeal cells, and its expression pattern varies with tumor type. In some tumors, IGFBP7 exhibits tumor suppressor activity in certain cancer types via regulation of cell proliferation, apoptosis, cell adhesion epithelial mesenchymal transition (EMT) and angiogenesis. However, IGFBP7 acts as a cancer-promoting gene in esophageal adenocarcinoma and neck squamous cell carcinomas. Together, IGFBP7 may provide potential value for the immunotherapy of cancer.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized C1qR1/CD93 Fc Chimera Protein, Human (Cat. No. UA011087) at 5.0μg/mL (100μL/well) can bind IGFBP-7 His Tag, Human (Cat. No. UA010394) with EC50 of 1.12-1.31μg/mL .