Skip to product information
1 of 1

Human PTH, His tag

Human PTH, His tag

Catalog Number: S0A8002 Brand: Starter
Price:
Regular price $35 USD
Regular price Sale price $35 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms parathormone; Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His)
MSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 11.2kDa Actual: 10-11kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Parathyroid hormone (PTH) is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. PTH acts to increase the concentration of calcium in the blood by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine.

Picture

SDS-PAGE

2μg (R: reducing conditions)