Skip to product information
1 of 1

Human Calretinin Protein, His tag

Human Calretinin Protein, His tag

Catalog Number: S0A6067 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $275 USD
Regular price Sale price $275 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CR, 29 kDa calbindin, CALB2, CAB29
Accession P22676
Amino Acid Sequence

Protein sequence (P22676, Met1-Met271, with C-His tag) MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM

Expression System HEK293
Molecular Weight Predicted MW: 33.2 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Calretinin is a calcium-binding protein involved in calcium signaling. Calretinin belongs to the troponin C superfamily. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. Calretinin is abundantly expressed in neurons including retina and cortical interneurons. Calretinin has an important role as a modulator of neuronal excitability including the induction of long-term potentiation. Loss of expression of calretinin in hippocampal interneurons has been suggested to be relevant in temporal lobe epilepsy. It is expressed in a number of other locations including hair follicles. Calretinin is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers.

Picture

SDS-PAGE

2μg(R: reducing conditions)