Skip to product information
1 of 1

GPA33 His Tag Protein, Human

GPA33 His Tag Protein, Human

Catalog Number: UA010503 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $642 USD
Regular price Sale price $642 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen GAP33
Synonyms Glycoprotein A33, Cell surface A33 antigen
Accession Q99795
Amino Acid Sequence

Ile22-Val235, with C-terminal 8* His ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 34-39kDa(Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sakamoto J., Kojima H., Kato J. Hamashima H., Suzuki H. Organ-specific expression of the intestinal epithelium-related antigen A33, a cell surface target for antibody-based imaging and treatment in gastrointestinal cancer. Cancer Chemother Pharmacol. 2000;46 Suppl: S27–32.2.Ackerman M.E., Chalouni C., Schmidt M.M., Raman V.V., Ritter G., Old L.J., Mellman I., Wittrup K.D. A33 antigen displays persistent surface expression. Cancer Immunol Immunother. 2008;57(7):1017–27.

Background

GpA33 is a cell-surface differentiation antigen that belongs to the immunoglobulin superfamily. The GpA33 encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. GpA33 antigen is a cell surface glycoprotein of the small intestine and colonic epithelium with homology to tight junction-associated proteins of the immunoglobulin superfamily, including CAR and JAM. Immunohistochemical study of normal tissues identified the large and small intestinal mucosa as the principal site of A33 expression. GpA33 is found in 95% of primary and metastatic colorectal cancers, with uniform expression throughout the tumors in most cases. Because of its presence only in the intestine or in tumors in the intestine, the gpA33 has been evaluated as a target for the detection and radioimmunotherapy of colon cancer tumors.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).