Skip to product information
1 of 1

Frizzled-4/FZD4 Fc Chimera Protein, Human

Frizzled-4/FZD4 Fc Chimera Protein, Human

Catalog Number: UA010439 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $410 USD
Regular price Sale price $410 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen Frizzled-4/FZD4
Synonyms Fz-4, hFz4, Frizzled-4
Accession Q9ULV1
Amino Acid Sequence

Phe37-Glu180, with C-terminal Human IgG Fc FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 50-55 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Hiroyuki Kirikoshi, Norihiko Sagara, Jun Koike, Katsuaki Tanaka, Hisahiko Sekihara, Momoki Hirai, Masaru Katoh. Molecular Cloning and Characterization of Human Frizzled-4 on Chromosome 11q14-q21. [J]. Biochemical and Biophysical Research Communications, 1999(3):955-961.2.Ke Zhang, Qun Lv, Liming Li, Mingjun Jiang, Fang Fang. Discovering the role of FZD4 Gene in human cutaneous squamous cell carcinoma.[G]. Indian Journal of Dermatology,2021-66-5-(484-489).

Background

Frizzled 4 (FZD4) is an important receptor for WNT proteins that stimulate several downstream signaling pathways. The FZD4 gene has been mapped to human chromosome 11q14-q21. FZD4 spans a total of 7392 nucleotides and encodes a 537-amino-acid protein with the N-terminal cysteine-rich domain, seven transmembrane domains, and the C-terminal S/T-X-V motif. The FZD4 mRNA of 7.7 kb in size were detected almost ubiquitously in normal human tissues and larger amounts in fetal kidney, adult heart, skeletal muscle, and ovary. Among cancer cell lines, the FZD4 mRNA level was higher in HeLa S3. The FZD4-Wnt interaction is involved in many types of cancers. The role of FZD4 in cutaneous squamous cell carcinoma (CSCC) has not been well studied.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).