Skip to product information
1 of 3

EPHA7 Protein

EPHA7 Protein

Catalog Number: UA080081 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $767 USD
Regular price Sale price $767 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession Q15375-1
Amino Acid Sequence

E595-V998(end)

ELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20mM Reduced Glu, 0.05% Brij-35, 10% glycerol, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Picture

Bioactivity

EPHA7 titration in HTRF assay

The EPHA7 activity was detected using HTRF technology. The reaction was performed by incubating the EPHA7 protein , ATP and substrate at 25℃ for 50 min, adding the beads at 25℃ for 60 min, then reading ratio 665/620 with BMG.

SDS-PAGE

SEC-HPLC