Product Details
Product Details
Product Specification
Species | Human |
Synonyms | Leukocyte immunoglobulin-like receptor subfamily A member 3 |
Accession | Q8N6C8 |
Amino Acid Sequence | Gly24-Glu439, with C-terminal 8*His GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHH |
Expression System | HEK293 |
Molecular Weight | 68-75kDa (Reducing) |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | PBS, pH7.4 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Picture
Picture
SDS-PAGE

1μg(R: reducing conditions, N: non-reducing conditions).
