Skip to product information
1 of 5

UltraNuclease 全能核酸酶

UltraNuclease 全能核酸酶

Catalog Number: UA070013 Reactivity: Other Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $109.00 SGD
Regular price Sale price $109.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Serratia marcescens
Synonyms SMNE,Nuclease, UltraNuclease, Benzonase
Amino Acid Sequence

Asp22-Asn266

DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

Expression System E.coli
Molecular Weight

27.7kDa (Reducing)

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer

10mM Tris (pH7.4), 500mM NaCl, 2mM MgCl2, 50% glycerol

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Reference

1.Nestle M, Roberts W K. An Extracellular Nuclease from Serratia marcescens I. PURIFICATION AND SOME PROPERTIES OF THE ENZYME[J]. Journal of Biological Chemistry, 1969, 244.

2.Kim W Y, Lee H S, Suh S J, et al. Purification and Cellular Localization of Extracellular Nuclease of Serratia marcescens Expressed in Escherichia coli[J]. Korean Journal of Microbiology, 1994, 32(2):147-154.

Background

Multi Nuclease all-around nuclease, also called broad-spectrum nucleic acid enzyme, is a kind of comes from Serratia Marcescens restriction endonuclease. It is capable of degradation of all forms of DNA and RNA (double-stranded, single-stranded, linear, circular or superhelical forms) under a very wide range of conditions (6Murea, 0.1M GuanidineHCl, 0.4%TritonX100, 0.1%SDS, 1mM EDTA, 1mM PMSF). The formation of 3-5 oligonucleotide residues containing 5 '-phosphate terminus is widely used to remove nucleic acids from biological products. The expression and purification of this product in Escherichia coli(E.coli) through genetic engineering can not only reduce the viscosity of cell supernatant and cell lysate in scientific research, but also improve the efficiency of protein purification and functional research. It can also be used in virus purification, vaccine production, protein and polysaccharide pharmaceutical industry as a host residual nucleic acid removal reagent, reducing the host residual nucleic acid to the peak (pg) level to improve the efficacy and safety of biological products. And can effectively prevent human peripheral blood monocyte (PBMC) clumping in cell therapy and vaccine research.

Components

Components

Amount

UltraNuclease *

250U/μL

Buffer Formulation

10mM Tris (pH7.4), 500mM NaCl, 2mM MgCl2, 50% glycerol

* One unit of Nuclease is defined as the amount of enzyme that causes a ∆A260 of 1.0 (equivalent to the complete digestion of 37μg DNA) in 30min.

Protocol

1.Sample preparation:

Adherent cells: Remove the medium, clean the cells with PBS, and remove the supernatant.

Suspension cells: Cells were collected by centrifugation, cleaned with PBS, centrifuged at 6,000rpm for 10min, and precipitates were collected.

Escherichia coli: The bacteria were collected by centrifugation, cleaned once with PBS, centrifuged at 8,000rpm for 5min, and precipitates were collected.

2.Sample treatment:

The collected cell precipitates are cleaved according to the ratio of mass (g) to volume (mL) to 1: (10~20). Cells can also be cleaved mechanically or chemically on ice or at room temperature (1g cells are about 109).

3.Enzyme addition:

the proportion of 1g cell precipitation digested by 250Units is required. You can also choose the addition plan according to the recommended dosage in the table above, increase the amount of enzyme within a certain range, and reduce the digestion time accordingly.

4.Supernatant acquisition:

The supernatant of cell lysis solution was obtained by centrifugation at 12,000rpm for 30min, and then subsequent related experiments were conducted.

Conditional parameter

Optimum condition

Applicable condition

Mg2+

1-2mM

1-10mM

PH

8.0

6-10

Temperature

37℃

0-42℃

DTT

0-100mM

>0mM

β-Me

0-100mM

>0mM

Monovalent cation

0-20mM

0-150mM

phosphate anion

0-10mM

0-100mM

Unit Definition

One unit of Nuclease is defined as the amount of enzyme that causes a ∆A260 of 1.0 (equivalent to the complete digestion of 37μg DNA) in 30min

Picture

Bioactivity

M marker1:Expi 293 Cell Lysis solution A(ultrasonicated).2:Expi 293 Cell Lysis solution B( non-ultrasonicated).3:Expi 293 Cell Lysis solution A+0.5μl UltraNuclease.4:Expi 293 Cell Lysis solution B+0.5μl UltraNuclease.5:Expi 293 Cell Lysis solution A+1μl UltraNuclease.6:Expi 293 Cell Lysis solution B+1μl UltraNuclease.Reaction condition: Incubate at 37℃ for 30mins.
M marker 1:0.2g/ml Escherichia coli lysate.2:0.2g/ml Escherichia coli lysate+1μl well-known UltraNuclease.3:0.2g/ml Escherichia coli lysate+1μl UltraNuclease.
M marker 1:10μg Salmon sperm DNA.2:37μg Salmon sperm DNA+0.5U UltraNuclease.3:37μg Salmon sperm DNA+0.75U UltraNuclease.4:37μg Salmon sperm DNA+1U UltraNuclease.
M marker 1:plasmid A.2:plasmid A+ UltraNuclease.3:plasmid B.4:plasmid B+ UltraNuclease.

SDS-PAGE

Complement UltraNuclease,1µg on SDS-PAGE under reducing and Non-reducing condition. The Purity is greater than 95%.