Skip to product information
1 of 2

CD63 Fc Chimera Protein, Human

CD63 Fc Chimera Protein, Human

Catalog Number: UA010511 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $604 USD
Regular price Sale price $604 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen CD63
Synonyms LAMP-3, MLA1, TSPAN30
Accession P08962
Amino Acid Sequence

Ala103-Val203, with C-terminal Human IgG Fc AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

45-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.J Biol Chem 2013 Jun28;288(26):19060-71. Epub 2013 Apr 30.

Background

CD63 is a member of the transmembrane-4 glycoprotein superfamily, known as tetraspanins. The tetraspanins contain four transmembrane domains, two extracellular loops flanked by short intracellular N and C termini, and a highly conserved sequence motif within the larger extracellular domain. Tetraspanins interact among themselves and with other transmembrane proteins to form membrane domains denoted tetraspanin-enriched microdomains (TEMs). At least in part through the TEMs, tetraspanins regulate a variety of cellular processes including cell fusion, intracellular trafficking, cell adhesion, motility, invasion, and cell differentiation. CD63 is among the most highly expressed tetraspanins in endothelial cells (ECs). Still, the role of CD63 in endothelial biology and angiogenesis remains to be addressed. We show that CD63 is co-localized with the type I integral lysosomal membrane protein (LAMP-1) but also present on the EC surface. By silencing CD63 expression in primary ECs, we demonstrate that CD63 associated with both β1 integrin and VEGFR2 in the plasma membrane and was required for VEGFR2-β1 integrin complex formation. Loss of CD63 expression disrupted downstream signaling path ways both in endothelial cells in culture and in intact tissues. As a consequence, CD63-deficient ECs failed to engage in sprouting angiogenesis and organize into tube structures.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CD63 Fc Chimera Protein, Human (Cat. No. UA010511) at 2μg/mL (100μL/well) can bind CD63 Recombinant Rabbit mAb,PBS Only (SDT-230-3) (Cat. No. S0B2141P) with EC50 of 1.78-2.51ng/ml.