Skip to product information
1 of 1

XIAP(Bir3) His Tag Protein, Human

XIAP(Bir3) His Tag Protein, Human

Catalog Number: UA010573 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $616 USD
Regular price Sale price $616 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen XIAP(Bir3)
Synonyms XIAP, API3, BIRC4, hIAP-3, hIAP3, IAP-3, ILP1, MIHA, XLP2
Accession P98170
Amino Acid Sequence

Asn252-Thr356, with N-terminal 6*His MHHHHHHNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT

Expression System E.coli
Molecular Weight 13kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Holcik M. et al. (2000) Functional Characterization of the X-Linked Inhibitor of Apoptosis (XIAP) Internal Ribosome Entry Site Element: Role of La Autoantigen in XIAP Translation. Mol Cell Biol. 20(13): 4648-57.

2、Winsauer G. et al. (2008) XIAP regulates bi-phasic NF-kappaB induction involving physical interaction and ubiquitination of MEKK2. Cell Signal. 20(11): 2107-12.

3、Suzuki Y. et al. (2001) X-linked inhibitor of apoptosis protein (XIAP) inhibits caspase-3 and -7 in distinct modes. J Biol Chem. 276(29): 27058-63.

Background

XIAP is a direct inhibitor of caspase-3 and -7, and suppresses the mitochondrial apoptotic pathway by inhibiting caspase-9. XIAPs comprised of 6 exons that encode XIAP, a 497 amino-acid protein whose functions include regulation of apoptosis and promotion of intracellular signaling during innate immunity. Currently, approximately 25 distinct XIAP mutations have been reported in patients with XIAP deficiency. Mutations reduce XIAP expression in half to two-thirds of patients, but missense mutations and C-terminal nonsense mutations or deletions allow for varying levels of expression of mutant protein. As is the case with SAP deficiency, female XIAP mutation carriers are asymptomatic. However, unlike SH2D1A carriers, XIAP carriers typically demonstrate skewed lyonization in lymphocytes in favor of cells retaining wild-type XIAP expression.

Picture

SDS-PAGE

3μg (R: reducing condition, N: non-reducing condition).