Skip to product information
1 of 1

TFPI His Tag Protein, Human

TFPI His Tag Protein, Human

Catalog Number: UA010123 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $560 USD
Regular price Sale price $560 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Tissue factor pathway inhibitor
Accession P10646
Amino Acid Sequence Asp29-Lys282, with C-terminal 10*His DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKHHHHHHHHHH
Expression System HEK293
Molecular Weight 44-50kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Tissue factor pathway inhibitor (TFPI) is also known as Extrinsic pathway inhibitor (EPI), Lipoprotein - associated coagulation inhibitor (LACI), is a plasma proteinase inhibitor synthesized by vascular endothelial cells and part of it is associated with glycosaminoglycans of these cells. TFPI is a single-chain polypeptide which can reversibly inhibit Factor Xa (Xa) and Thrombin (Factor IIa). TFPI is a secreted protein with a N­terminal acidic region, three Kunitz (K) domains separated with by two linker regions, and a C­terminal basic region. The first K domain inhibits coagulation factor VIIa complexed to tissue factor (TF); The second K domain inhibits factor Xa; The third K domain binds to heparin; The C­terminal basic region may have several functions. For example, it plays an important role in binding of TFPI to cell surfaces.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).