Immobilized Human IgG1 Fc (Cat. No. S0A0052) at 4 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag with EC50 of 7.864-9.985 ng/ ml.
Product Details
Product Details
Product Specification
| Species | Staphylococcus aureus |
| Synonyms | IgG-binding protein A, Staphylococcal protein A (SpA), spa |
| Accession | P02976 |
| Amino Acid Sequence | Protein sequence (P02976, Met212-Lys269, with C-His tag)MADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 8.4 kDaObserved MW: 8.4 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Protein A is a 42 kDa surface protein originally found in the cell wall of the bacteria Staphylococcus aureus. It is encoded by the spa gene and its regulation is controlled by DNA topology, cellular osmolarity, and a two-component system called ArlS-ArlR. It has found use in biochemical research because of its ability to bind immunoglobulins. It is composed of five homologous Ig-binding domains that fold into a three-helix bundle. Each domain is able to bind proteins from many mammalian species, most notably IgGs. It binds the heavy chain within the Fc region of most immunoglobulins and also within the Fab region in the case of the human VH3 family. Through these interactions in serum, where IgG molecules are bound in the wrong orientation (in relation to normal antibody function), the bacteria disrupts opsonization and phagocytosis.
Picture
Picture
Bioactivity
Immobilized Human IgG2 Fc (Cat. No. S0A0053) at 20 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag with EC50 of 12.95-15.57 ng/ ml.
SDS-PAGE
2 μg(R: reducing conditions)
