Skip to product information
1 of 4

SIRP-α/CD172A Fc Chimera Protein, Mouse

SIRP-α/CD172A Fc Chimera Protein, Mouse

Catalog Number: UA010647 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $502 USD
Regular price Sale price $502 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms BIT, MFR, MYD1, P84, PTPNS1,SHP substrate 1, SHPS1, SHPS1, CD172A
Accession P97797-1
Amino Acid Sequence

Lys32-Asn373, with C-terminal Human IgG Fc KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 95-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Barclay, A.N. & M.H. Brown (2006) Nat. Rev. Immunol. 6:457. 2. vanBeek, E.M. et al. (2005) J. Immunol. 175:7781. 3. Liu, Y. et al. (2005) J. Biol. Chem. 280:36132. 4. Kharitonenkov, A. et al. (1997) Nature 386:181.

Background

Signal regulatory protein alpha (SIRP alpha, designated CD172a), also called SHPS-1 (SHP substrate 1) and previously, MyD-1 (Myeloid/Dendritic-1), is a monomeric ~90 kDa type I transmembrane glycoprotein that belongs to the SIRP/SHPS (CD172) family of the immunoglobulin superfamily. SIRPs are paired receptors, with similar extracellular domains but differing C-termini and functions. The 503 amino acid (aa) human SIRP alpha contains a 342 aa extracellular domain (ECD), with one V-type, and two C1 type Ig domains, and three potential N glycosylation sites. It has a 110 aa cytoplasmic sequence with ITIM motifs that recruit tyrosine phosphatases SHP-1 and SHP-2 when phosphorylated.SIRP alpha is expressed mainly on myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It is also found on neurons, smooth muscle and endothelial cells. SIRP alpha shows adhesion to the ubiquitous CD47/IAP (integrin associated protein), while SIRP gamma binds more weakly and SIRP alpha 1 does not bind at all.Mouse and human SIRP alpha -CD47 binding only cross-reacts for specific polymorphisms and influences engraftment of xenotransplanted stem cells. SIRP alpha engagement generally produces a negative regulatory signal. Low SIRP alpha recognition of CD47, which occurs on aged erythrocytes or platelets or xenogenic cells, promotes clearance of CD47low cells from circulation. SIRP alpha recognition of surfactants SP-A and SP-D in the lung can inhibit alveolar macrophage cytokine production.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized CD47 His Tag, Mouse (Cat. No. UA010446) at 2.0μg/mL (100μL/well) can bind SIRP-α/CD172A Fc Chimera, Mouse (Cat. No. UA010647) with EC50 of 27.10-36.13ng/mL .

SPR

Protein A Chip captured SIRP-α/CD172A Fc Chimera, Mouse(Cat. No. UA010647), can bind CD47 His Tag, Mouse (Cat. No. UA010446) with an affinity constant of 1.56μM as determined in SPR assay.