SARS-CoV-2 (BA.2/Omicron) RBD, His Tag

Catalog Number: S0A2003 Brand: Starter

Price:

$250 USD

Size: 50μg 100μg 500μg

Quantity:

For shipping services or bulk orders, you may request a quotation.

Secure checkout with

View full details

Product Details

Product Specification

Species	SARS-CoV-2
Accession	P0DTC2
Amino Acid Sequence	RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	35 kDa
Purity	>90%
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	with C-His Tag
Physical Appearance	Lyophilized powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.