Skip to product information
1 of 2

SARS-CoV-2 (BA.2.12.1/Omicron) RBD, His Tag

SARS-CoV-2 (BA.2.12.1/Omicron) RBD, His Tag

Catalog Number: S0A2015 Brand: Starter
Price:
Regular price $250 USD
Regular price Sale price $250 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence

Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His)


RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYQYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGFNCYFPLRSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 26.5kDa Actual: 35kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Picture

Bioactivity

Immobilized SARS-CoV-2 (BA.2.12.1/Omicron) RBD, His Tag at 4 μg/mL (50 μL/well) can bind Human ACE2, hFc tag (S0A0071) with EC50 of 21.98-31.28 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)