Skip to product information
1 of 1

S100A8 Protein, Human

S100A8 Protein, Human

Catalog Number: UA030066 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $204 USD
Regular price Sale price $204 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Calgranulin-A; Cystic fibrosis antigen; Leukocyte L1 complex light chain; MRP-8
Accession P05109
Amino Acid Sequence

Met1-Glu93 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Expression System E.coli
Molecular Weight

12kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

pH7.5,20mMTris,300mM NaCl

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. . and Anna L Gharibyan (2012) Int J Mol Sci. 13(3):2893-2917

Background

S100A8 protein became the focus of intensive current research due to their association with numerous human disorders, including acute and chronic inflammatory conditions, autoimmune diseases, cancer, atherosclerosis, cardiomyopathies and neurodegenerative diseases, as well as due to their crucial roles in normal physiological processes within cells. S100A8 belongs to the family of low molecular weight S100 proteins (10–13 kDa) comprising 22 members to date and representing the largest subfamily of the EF-hand Ca2+-binding proteins. All S100 proteins share conserved structural motifs of two EF-hand Ca2+-binding domains connected by a variable hinge region that often confer biological activity. The tendency to form homodimers is common to all S100 proteins, including S100A8 and S100A9, with one exception—calbindin D9k is monomeric. Some members of the S100 protein family are also able to form heterodimers as observed f.e. for S100A8 and S100A9 or S100A1 and S100P, which suggests different functions for homo- and heterodimers.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Measured in a cell proliferation assay using L-929 mouse fibrosarcoma cells, the EC50 for this effect is less than 0.1ng/ml.