Skip to product information
1 of 1

Rhesus macaque IFNA13 Protein, His Tag

Rhesus macaque IFNA13 Protein, His Tag

Catalog Number: S0A0209 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rhesus macaque
Synonyms Interferon, alpha 13
Accession A0A5F8AJA6
Amino Acid Sequence

Protein sequence (A0A5F8AJA6, Cys25-Leu182, with C-His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL

Expression System HEK293
Molecular Weight Predicted MW: 20 kDaObserved MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFNA13, or Interferon Alpha-13, is a member of the type I interferon (IFN) family, a group of cytokines crucial for innate immunity against viral infections. It signals through the shared IFNAR1/IFNAR2 receptor complex to activate the JAK-STAT pathway. This leads to the expression of interferon-stimulated genes (ISGs) that establish an antiviral state in cells. IFNA13 is implicated in the early immune response. Research suggests its expression and potential roles may vary in different pathological contexts, including viral diseases and certain cancers, warranting further investigation into its unique biological activities.

Picture

SDS-PAGE

2μg(R: reducing conditions)