Skip to product information
1 of 1

Rat IgA Protein, His Tag

Rat IgA Protein, His Tag

Catalog Number: S0A6058 Brand: Starter
Price:
Regular price $15 USD
Regular price Sale price $15 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rat
Synonyms Immunoglobulin A
Accession CAD52870.1
Amino Acid Sequence

Protein sequence (CAD52870.1, Pro110-Try339, with C-His Tag) PRLSLQRPALEDLLLGSEASLTCTLRGLKEPTGAVFTWQPTTGKDAVQKEAVQDSCGCYTVSSVLPGCAERWNNGETFTCTATHPEFETPLTGEIAKVTENTFPPQVHLLPPPSEELALNELVSLTCLVRGFNPKDVLVRWLQGNEELPSESYLVFEPLREPGEGAITYLVTSVLRVSAETWKQGAQYSCMVGHEALPMSFTQKTIDRLSGKPTNVNVSVIMSEGDGICY

Expression System HEK293
Molecular Weight Predicted MW: 26.8 kDaObserved MW: 27-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Rat Immunoglobulin A (IgA) is a key antibody isotype mediating mucosal immunity in rodents. It exists predominantly in a dimeric form stabilized by the joining (J) chain, facilitating polymeric immunoglobulin receptor (pIgR)-dependent transcytosis across epithelial surfaces into secretions such as bile, intestinal lumen, and milk. In rats, IgA plays a critical role in gut homeostasis by neutralizing pathogens and regulating commensal microbiota without eliciting pro-inflammatory responses. Structurally, rat IgA features four heavy chain constant region domains (Cα1–Cα4) and is heavily glycosylated, which influences its stability and interaction with immune cells via Fcα receptors. It is widely utilized in preclinical models to study mucosal vaccine efficacy, inflammatory bowel disease, and hepatobiliary transport mechanisms.

Picture

SDS-PAGE

2μg(R: reducing conditions)