Skip to product information
1 of 1

Pig Intrinsic Factor Protein, His Tag

Pig Intrinsic Factor Protein, His Tag

Catalog Number: S0A9068 Brand: Starter
Price:
Regular price $275 USD
Regular price Sale price $275 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Synonyms Cobalamin binding intrinsic factor, CBLIF
Accession A0A8D1ENZ1
Amino Acid Sequence

Protein sequence (A0A8D1ENZ1, Ser27-Try425(S90T, R247Q), with C-His Tag) STQTRSSCSVPSAEQPLVNGIQVLMEQSVTSSAFPNPSILIAMNLAGAYNTEAQELLTYKLMATNTSDLTTGQLALTIMALTSSCRDPGNRIAILQGQMENWAPPSLDTHASTFYEPSLGILTLCQNNPEKTLPLAARFAKTLLANSSPFNMDTGAMATLALTCMYNKIPVGSEEGYRALFSQVLRNTVENISMRIQDNGIIGNIYSTGLAMQALSVTPEQPNKEWDCQKTMDTVLTEIKEGKFHNPMAIAQILPSLKGKTYLDVPHVSCSPGHEVPPTLPNHPSPVPTPAPNITVIYTINNQLRGVELLFNETISVSVKRGSVLLIVLEEAQRKNPKFKFETTMTSWGPVVSSINNIAENVNHRTYWQFLSGQTPLNEGVADYIPFNHEHITANFTQY

Expression System HEK293
Molecular Weight Predicted MW: 45.4 kDa Observed MW: 50-55 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cobalamin-binding intrinsic factor (CBLIF) is a glycoprotein primarily secreted by gastric parietal cells in pigs, which plays a vital role in cobalamin (vitamin B12) absorption. It binds to dietary cobalamin with high specificity in the stomach, forming a stable complex. This CBLIF-cobalamin complex is resistant to intestinal degradation and is specifically recognized by cubilin receptors on the mucosal surface of the distal ileum, facilitating its active transport into enterocytes. Therefore, CBLIF is essential for the efficient uptake and systemic delivery of vitamin B12, a critical cofactor for DNA synthesis and red blood cell formation.

Picture

SDS-PAGE

2μg(R: reducing conditions)