Skip to product information
1 of 3

NRAS, Avi&His Tag Protein

NRAS, Avi&His Tag Protein

Catalog Number: UA080010 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $774 USD
Regular price Sale price $774 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms ALPS4, CMNS, N-ras, NCMS, NRAS1, NS6
Accession P01111
Amino Acid Sequence

M1-N172

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLN

Expression System E.coli
Molecular Weight 23.6 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

-80℃

Picture

Bioactivity

NRAS enzyme titration

The NRAS activity was detected using HTRF technology. The reaction was performed by incubating the varying concentration
of BI-2852, NRAS protein, substrate and beads at 25℃ for 60 min, then reading ratio 665/620 with BMG.

SDS-PAGE