Skip to product information
1 of 2

Nipah Virus Glycoprotein G His Tag Protein

Nipah Virus Glycoprotein G His Tag Protein

Catalog Number: UA019075 Brand: UA BIOSCIENCE
Price:
Regular price $5 USD
Regular price Sale price $5 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Synonyms Glycoprotein G
Accession Q9IH62
Amino Acid Sequence

Protein sequence (Q9IH62, Gln71-Thr602, with N-His Tag) QNYTRSTDNQAVIKDALQGIQQQIKGLADKIGTEIGPKVSLIDTSSTITIPANIGLLGSKISQSTASINENVNEKCKFTLPPLKIHECNISCPNPLPFREYRPQTEGVSNLVGLPNNICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSDGENPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISRPGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCT

Expression System HEK293
Molecular Weight

Predicted MW: 61 kDaObserved MW: 70-90 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The Nipah virus Glycoprotein G (NiV-G) is a surface attachment protein essential for viral entry. It forms tetramers that recognize and bind to cellular receptors ephrin-B2 and ephrin-B3, which are highly conserved in mammals. Following receptor binding, the fusion protein (F) is triggered to mediate membrane fusion. NiV-G is a primary target for neutralizing antibodies, making it a key component of vaccine and antiviral research. Due to Nipah virus's high pathogenicity and biosafety level 4 classification, studies of G protein structure and function are critical for developing countermeasures against this deadly paramyxovirus.

Picture

Bioactivity

Immobilized Nipah Virus Glycoprotein G Protein, His Tag at 5 μg/mL (100 μL/well) can bind Human Ephrin-B2 / EFNB2 Protein, Fc tag (MALS verified) with EC50 of 7.4-9.6 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)